PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn337101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 987aa    MW: 108384 Da    PI: 9.2991
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn337101genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP42.69.8e-145836143971
     E2F_TDP  39 vknkrRRiYDilNVLealnliekkekneirwkg 71 
                 +kn+rRR+YD++NVL+al+++ k ek+eirw+g
  Achn337101 583 EKNIRRRVYDAINVLMALDIVIK-EKKEIRWNG 614
                 799********************.*******98 PP

2zf-Dof118.72.2e-37735794362
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalr vPvGgg+r+nkks+
  Achn337101 735 EAALKCPRCESTNTKFCYFNNYSLAQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKKSK 794
                 6789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF024855.7E-2565184IPR003406Glycosyl transferase, family 14
PfamPF024851.5E-64210468IPR003406Glycosyl transferase, family 14
SMARTSM013721.8E-4533614IPR003316E2F/DP family, winged-helix DNA-binding domain
SuperFamilySSF467851.63E-9577615IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.101.7E-16580618IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF023194.3E-11582614IPR003316E2F/DP family, winged-helix DNA-binding domain
ProDomPD0074781.0E-33722789IPR003851Zinc finger, Dof-type
PfamPF027011.1E-31737792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.059738792IPR003851Zinc finger, Dof-type
PROSITE patternPS013610740776IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005667Cellular Componenttranscription factor complex
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008375Molecular Functionacetylglucosaminyltransferase activity
GO:0015020Molecular Functionglucuronosyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 987 aa     Download sequence    Send to blast
MKRTHIHFAL CSNRKWLIPL LFVSTISLIV VLIASPAQDK SNRTANSSED SDANSGGRPP  60
EPPRLAYLLS GTGGDGPRMR RLLLAAYHPR NYYLLHLDLG ASDAERLELA KYVKSEAVVR  120
EFGNVMVVGK PDPVTYKGPT MIARTLHAVA ILLKKAKWDW FINLSASDYP LVPQDVLIAS  180
PAQDKSNRTA NSSEDSDANS GGRPPEPPRL AYLLSGTGGD GPRMRRLLLA AYHPRNYYLL  240
HLDLGASDAE RLELAKYVKS EAVVREFGNV MVVGKPDPVT YKGPTMIART LHAVAILLKK  300
AKWDWFINLS ASDYPLVPQD DLLHIFSYLP RDLKFLDHTS DIGWKEVQRA RPIIIDPGLY  360
HSKKSGVFWA KEKRSLPSSF KLFMGSEWVV LTRSFLEFSV WGWDNLPRTL LMYYTNFMES  420
PDGYFHTLVC NHKDYQNTTV NHDLRYIRWD NPPKEHPMNL TLEHFDDMVQ SGAPFAHTFA  480
KDDPVLDKID QDLLKRSDGR FTPGGWCTGN SVLDKDPCVV HGSSYAVKPS VVGNMDGMML  540
MAQVVGGDVA VGKGGGGAGS DGVGDGREQR WRHWWSGGGE FAEKNIRRRV YDAINVLMAL  600
DIVIKEKKEI RWNGLPSANG KDMEEIKALR LKLMDRIGKK AAYLKEVEEQ NPINFYKRER  660
SRTMNFSSIP AYLDPSNWQQ QPNAQLGSGS GSGSGSGGNC PPPPPPPLQG GGGSGSIRPG  720
SLADRARLAN IPMPEAALKC PRCESTNTKF CYFNNYSLAQ PRHFCKTCRR YWTRGGALRS  780
VPVGGGCRRN KKSKGNSSKS PATGDRQTST SISGGSTSGA SFTSTATLLG LTPQIPPLRF  840
MAPPSQLTEY DGGETGLNYS GIPATSDMNM NFQLLGSGSL GGGSGSYGSG YGPWAGLDLP  900
YGLYPFQGST SVPSSYVGEF NQVRPKISDL GLTQPGSVKM EENGQEMNLS RQFSGIQGND  960
HYSWTGNPAW TDFSGFSSSS TTHNHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027048.10.0Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein
TrEMBLA0A061ER800.0A0A061ER80_THECC; Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.16e-41DNA binding with one finger 2.4